PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000098G0310
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB_related
Protein Properties Length: 188aa    MW: 21191.7 Da    PI: 5.2923
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000098G0310genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.87.6e-111653140
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqc 40
                     r rW +eE+ +++da  ++G + Wk+I +++g ++t  q+
  PH01000098G0310 16 RERWGAEEHGRFLDALLMFGRD-WKKIEEHVG-TKTTIQI 53
                     78******************77.*********.***9887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.87E-10760IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-71453IPR006447Myb domain, plants
PROSITE profilePS5129311.5421465IPR017884SANT domain
SMARTSM007172.3E-51563IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-61558IPR009057Homeodomain-like
PfamPF002495.9E-81657IPR001005SANT/Myb domain
CDDcd001673.96E-41860No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MPEKKERKPY TVTKPRERWG AEEHGRFLDA LLMFGRDWKK IEEHVGTKTT IQISIRFERV  60
NELGNVIARN FTELSNFDWA GTSAWVNHGA ESQTEPAATH PSDNSFMGTP SFSNMSMDWA  120
GNTSEASAIG DVQDGTIQLP LSPDDLHFAR VYRFIGDIFD PNTPCPIEAH LQKLKDMDHI  180
TVKTQQD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0693302e-43BT069330.2 Zea mays full-length cDNA clone ZM_BFc0100G09 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002455171.14e-67hypothetical protein SORBIDRAFT_03g005480
TrEMBLM8AE978e-78M8AE97_TRIUA; Transcription factor ASG4
STRINGBGIOSGA002364-PA1e-70(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36423170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.21e-27MYB_related family protein